Invitrogen™ Human KRT81 (aa 293-326) Control Fragment Recombinant Protein

Product Code. 30205821

Brand: Invitrogen™ RP105621

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65582 (PA5-65582. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix.

Specifications

• Accession Number: Q14533
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3887
• Name: Human KRT81 (aa 293-326) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA589625; ghHb1; ghHkb1; Hair keratin K2.9; hard keratin, type II, 1; HB1; Hb-1; hHAKB2-1; K81; Kb21; keratin 81; keratin 81, type II; keratin complex 2, basic, gene 19; keratin, hair, basic, 1; Keratin, type II cuticular Hb1; keratin-81; Krt2-19; KRT81; KRTHB1; Metastatic lymph node 137 gene protein; MLN 137; MLN137; type II hair keratin Hb1; type II keratin Kb21; type-II keratin Kb21
• Common Name: KRT81
• Gene Symbol: KRT81
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining