Invitrogen™ Human KRIT1 (aa 471-585) Control Fragment Recombinant Protein

Product Code. 30194799

Brand: Invitrogen™ RP92586

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62020 (PA5-62020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

Specifications

• Accession Number: O00522
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 889
• Name: Human KRIT1 (aa 471-585) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010007K12Rik; A630036P20Rik; AA432855; AI450393; AI643869; ankyrin repeat-containing protein Krit1; BB155247; BB235701; CAM; Ccm1; Cerebral cavernous malformations 1 protein; cerebral cavernous malformations 1 protein homolog; Krev interaction trapped 1; krev interaction trapped protein 1; KRIT1; KRIT1, ankyrin repeat containing; RGD1305929
• Common Name: KRIT1
• Gene Symbol: KRIT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining