missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KPNA6 (aa 29-105) Control Fragment Recombinant Protein

Product Code. 30193736
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193736

Brand: Invitrogen™ RP91826

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53867 (PA5-53867. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Karyopherin, a cytosolic and heterodimeric protein complex consisting of alpha and beta subunits, is responsible for targeting proteins with nuclear localization signals to the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. The alpha subunit and imported substrate enter the nucleus and accumulate in the nucleoplasm, while the beta subunit accumulates at the NPC. KPNA6 belongs to a subfamily within the KPNA family that also includes IPOA5&6. Down-regulation of KPNA6 by RNAi expression in HeLa cells strongly inhibited cell proliferation, possibly due to blocking the nuclear import of specific factors essential for cell growth and proliferation. KPNA6 also interacts with the Rev protein of HIV-1 and promote its nuclear import.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60684
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23633
Name Human KPNA6 (aa 29-105) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ11249; importin alpha 7 subunit; importin alpha-S2; Importin subunit alpha-7; importin-alpha-S2; IPOA7; karyopherin (importin) alpha 5; karyopherin (importin) alpha 6; karyopherin alpha 6; karyopherin alpha 6 (importin alpha 7); karyopherin subunit alpha 6; karyopherin subunit alpha-6; Kpna5; Kpna6; KPNA7; MGC17918; NPI-2; RP4-622L5.1
Common Name KPNA6
Gene Symbol KPNA6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.