missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KPNA1 (aa 44-75) Control Fragment Recombinant Protein

Product Code. 30207975
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207975

Brand: Invitrogen™ RP105260

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84596 (PA5-84596. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Recombination activating proteins RAG1 and RAG2 regulate and mediate VJ recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in VJ recombination. Two transcript variants, one protein-coding and the other not, have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P52294
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3836
Name Human KPNA1 (aa 44-75) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW494490; IMA2; Importin alpha 2; importin alpha 5; Importin alpha P1; importin alpha-5; importin alpha-S1; importin subunit alpha-1; importin subunit alpha-5; Importin subunit alpha-5, N-terminally processed; importin-alpha-S1; IPOA 1; IPOA1; IPOA5; karyopherin (importin) alpha 1; Karyopherin A2; karyopherin alpha 1; karyopherin alpha 1 (importin alpha 5); karyopherin subunit alpha 1; karyopherin subunit alpha-1; karyopherin/importin alpha-1; KPNA1; KPNA2; m-importin-alpha-S1; mSRP1; NPI1; NPI-1; Nucleoprotein interactor 1; RAG cohort 1; RAG cohort protein 2; RCH 1; RCH1; RCH2; recombination activating gene cohort 2; SRP 1; SRP1; SRP1 alpha; SRP1-beta
Common Name KPNA1
Gene Symbol KPNA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LFKRRNVATAEEETEEEVMSDGGFHEAQISNM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.