Invitrogen™ Human KPNA1 (aa 44-75) Control Fragment Recombinant Protein

Product Code. 30207975

Brand: Invitrogen™ RP105260

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84596 (PA5-84596. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Recombination activating proteins RAG1 and RAG2 regulate and mediate VJ recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in VJ recombination. Two transcript variants, one protein-coding and the other not, have been found for this gene.

Specifications

• Accession Number: P52294
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3836
• Name: Human KPNA1 (aa 44-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW494490; IMA2; Importin alpha 2; importin alpha 5; Importin alpha P1; importin alpha-5; importin alpha-S1; importin subunit alpha-1; importin subunit alpha-5; Importin subunit alpha-5, N-terminally processed; importin-alpha-S1; IPOA 1; IPOA1; IPOA5; karyopherin (importin) alpha 1; Karyopherin A2; karyopherin alpha 1; karyopherin alpha 1 (importin alpha 5); karyopherin subunit alpha 1; karyopherin subunit alpha-1; karyopherin/importin alpha-1; KPNA1; KPNA2; m-importin-alpha-S1; mSRP1; NPI1; NPI-1; Nucleoprotein interactor 1; RAG cohort 1; RAG cohort protein 2; RCH 1; RCH1; RCH2; recombination activating gene cohort 2; SRP 1; SRP1; SRP1 alpha; SRP1-beta
• Common Name: KPNA1
• Gene Symbol: KPNA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFKRRNVATAEEETEEEVMSDGGFHEAQISNM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining