missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203471

Invitrogen™ Human KNP-I (aa 24-104) Control Fragment Recombinant Protein

Product Code. 30203471
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203471 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203471 Supplier Invitrogen™ Supplier No. RP91785

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53828 (PA5-53828. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P0DPI2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8209
Name Human KNP-I (aa 24-104) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C21orf33; chromosome 21 open reading frame 33; ES1; ES1 protein homolog, mitochondrial; GATD3A; GATD3B; Glutamine amidotransferase-like class 1 domain-containing protein 3 A, mitochondrial; Glutamine amidotransferase-like class 1 domain-containing protein 3 B, mitochondrial; GT335; H KNPH; HES1; human HES1 protein, homolog to E.coli and zebrafish ES1 protein; Keio novel protein I; Keio novel protein-I; KNPH; KNPI; KNP-I; Protein GT335; Protein HES1; testis secretory sperm-binding protein Li 237 E
Common Name KNP-I
Gene Symbol GATD3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.