Invitrogen™ Human KMT2E (aa 964-1057) Control Fragment Recombinant Protein

Product Code. 30202819

Brand: Invitrogen™ RP101713

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63249 (PA5-63249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mixed lineage leukemia (MLL) gene family comprise a group of Histone H3 lysine 4 (H3K4) methyltransferases within the larger SET1 family. The founding member MLL commonly undergoes translocations in infantile leukemia and displays increased expression in some adult myeloid leukemias. MLL2, also designated ALR, exists within a complex of proteins. MLL2 is important for mouse embryonic development and may be involved in adhesion-related cytoskeletal events affecting cell growth and survival. The MLL2 gene maps to the human locus 19q13.1, which is a frequent target of rearrangement or amplification in solid tumors. MLL3 or its paralogue MLL4 associate with activating signal cointegrator-2 (ASC-2), which regulates ligand-dependent H3K4 trimethylation and expression of LXR-target genes. MLL3 maps to a location on human chromosome 7 that is often deleted in myeloid disorders. MLL3 also exhibits higher expression in peripheral blood, placenta, pancreas, testis, and fetal thymus. MLL5 localizes to the nucleus and forms intranuclear protein complexes, which may regulate chromatin remodeling and cellular growth suppression. The gene encoding human MLL5 lies within chromosome band 7q22.3, a region deleted in cytogenetic aberrations of acute myeloid malignancies.

Specifications

• Accession Number: Q8IZD2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55904
• Name: Human KMT2E (aa 964-1057) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810033J14Rik; 9530077A04Rik; D230038D11Rik; HDCMC04P; histone-lysine N-methyltransferase 2 E; histone-lysine N-methyltransferase MLL5; Inactive histone-lysine N-methyltransferase 2 E; Inactive lysine N-methyltransferase 2 E; KMT2E; lysine (K)-specific methyltransferase 2 E; lysine methyltransferase 2 E; lysine N-methyltransferase 2 E; MGC70452; MLL5; myeloid/lymphoid or mixed-lineage leukemia 5; myeloid/lymphoid or mixed-lineage leukemia 5 (trithorax homolog, Drosophila); myeloid/lymphoid or mixed-lineage leukemia protein 5; Myeloid/lymphoid or mixed-lineage leukemia protein 5 homolog; NKp44L
• Common Name: KMT2E
• Gene Symbol: KMT2E
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPVSDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining