Invitrogen™ Human KLRF1 (aa 73-145) Control Fragment Recombinant Protein

Product Code. 30210500

Brand: Invitrogen™ RP108908

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139821 (PA5-139821. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release (Kuttruff et al., 2009 ).

Specifications

• Accession Number: Q9NZS2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51348
• Name: Human KLRF1 (aa 73-145) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Activating coreceptor NKp80; CLEC5C; CLEC5CMGC119908; C-type lectin domain family 5 member C; killer cell lectin like receptor F1; killer cell lectin-like receptor F1; killer cell lectin-like receptor subfamily F member 1; killer cell lectin-like receptor subfamily F, member 1; KLRF1; Lectin-like receptor F1; MGC119907; MGC119909; ML; natural killer cell receptor; NKp80
• Common Name: KLRF1
• Gene Symbol: KLRF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining