missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KLHL41 (aa 184-250) Control Fragment Recombinant Protein

Product Code. 30200459
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200459 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200459 Supplier Invitrogen™ Supplier No. RP93586

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54500 (PA5-54500. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLHL41 is involved in skeletal muscle development and differentiation. It regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils. It is required for pseudopod elongation in transformed cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60662
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10324
Name Human KLHL41 (aa 184-250) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Gm112; KBTBD10; kelch like family member 41; kelch related protein 1; kelch repeat and BTB (POZ) domain containing 10; kelch repeat and BTB domain-containing protein 10; kelch-like 41; kelch-like family member 41; kelch-like protein 41; Kelch-related protein 1; Kel-like protein 23; Klhl41; KRP1; sarcomeric muscle protein; Sarcosin
Common Name KLHL41
Gene Symbol KLHL41
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.