Invitrogen™ Human KLHL41 (aa 184-250) Control Fragment Recombinant Protein

Product Code. 30200459

Brand: Invitrogen™ RP93586

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54500 (PA5-54500. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLHL41 is involved in skeletal muscle development and differentiation. It regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils. It is required for pseudopod elongation in transformed cells.

Specifications

• Accession Number: O60662
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10324
• Name: Human KLHL41 (aa 184-250) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gm112; KBTBD10; kelch like family member 41; kelch related protein 1; kelch repeat and BTB (POZ) domain containing 10; kelch repeat and BTB domain-containing protein 10; kelch-like 41; kelch-like family member 41; kelch-like protein 41; Kelch-related protein 1; Kel-like protein 23; Klhl41; KRP1; sarcomeric muscle protein; Sarcosin
• Common Name: KLHL41
• Gene Symbol: KLHL41
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining