Invitrogen™ Human KLHL34 (aa 472-553) Control Fragment Recombinant Protein

Product Code. 30208123

Brand: Invitrogen™ RP101564

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63834 (PA5-63834. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLHL34 (Kelch Like Family Member 34) is a Protein Coding gene. An important paralog of this gene is KLHL13.

Specifications

• Accession Number: Q8N239
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 257240
• Name: Human KLHL34 (aa 472-553) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FLJ34960 antibody; kelch like family member 34; kelch-like 34; kelch-like 34 (Drosophila) antibody; kelch-like family member 34; kelch-like protein 34; kelch-like protein 34 antibody; KLHL34; KLHL34 antibody; MGC125650 antibody; RGD1560439; RP11-450P7.3
• Common Name: KLHL34
• Gene Symbol: KLHL34
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DRGVVYISGGKAGRGEGGASSLRDLYVLGPEEQVWSKKAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDPGADQWTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining