Invitrogen™ Human KLHL3 (aa 1-32) Control Fragment Recombinant Protein

Product Code. 30195709

Brand: Invitrogen™ RP101343

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62369 (PA5-62369. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Specifications

• Accession Number: Q9UH77
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26249
• Name: Human KLHL3 (aa 1-32) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 7530408C15Rik; AI430941; EG627648; kelch like family member 3; kelch-like 3; kelch-like family member 3; kelch-like protein 3; KIAA1129; Klhl3; PHA2D; RGD1565218
• Common Name: KLHL3
• Gene Symbol: KLHL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining