Invitrogen™ Human KLHL1 (aa 85-150) Control Fragment Recombinant Protein

Product Code. 30199399

Brand: Invitrogen™ RP93583

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110870 (PA5-110870. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mammalian Kelch-like 1 (KLHL1) was initially discovered as a homolog to the Drosophila Kelch gene that is highly expressed in several brain tissues. The predicted protein domain structure of KLHL1 is characteristic of a number of proteins that bind actin, form dimers, and often act as actin-organizing proteins. Based on the presence of anti-sense RNA that spans the transcription and translation start sites as well as the first splice site of KLHL1 in brain tissue of individuals suffering from the neurodegenerative disorder spinocerebellar ataxia type 8 (SCA8), it has been suggested that KLHL1 is involved this disease and that regulation of KLHL1 protein may be affected by antisense RNA expression.

Specifications

• Accession Number: Q9NR64
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57626
• Name: Human KLHL1 (aa 85-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FLJ30047; kelch like family member 1; kelch-l like; kelch-like 1; kelch-like family member 1; kelch-like protein 1; KIAA1490; Klhl1; Mayven-related protein 2; mKIAA1490; MRP2; RP11-394C23.1
• Common Name: KLHL1
• Gene Symbol: KLHL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTLFYVESLEEEVVPGMDFPGPHEKGLVLQELKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining