Invitrogen™ Human KLHDC9 (aa 87-175) Control Fragment Recombinant Protein

Product Code. 30194442

Brand: Invitrogen™ RP94406

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56911 (PA5-56911. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLHDC9 gene ontology annotations related to this gene include cyclin binding.

Specifications

• Accession Number: Q8NEP7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126823
• Name: Human KLHDC9 (aa 87-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190002J23Rik; AA087357; ESTM31; KARCA1; kelch domain containing 9; kelch domain-containing protein 9; kelch domain-containing protein 9; LOW QUALITY PROTEIN: kelch domain-containing protein 9; kelch/ankyrin repeat containing cyclin A1 interacting protein; kelch/ankyrin repeat-containing cyclin A1-interacting protein; Klhdc9; RGD1561025
• Common Name: KLHDC9
• Gene Symbol: KLHDC9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRISDRELQVAGREGGIHTQRRYGSIYTLRLDPSARTY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining