Invitrogen™ Human KLDC3 (aa 87-181) Control Fragment Recombinant Protein

Product Code. 30196467

Brand: Invitrogen™ RP94800

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56359 (PA5-56359. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The BTB (Broad-Complex, Tramtrack and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. The Kelch domain-containing protein 3 (KLHDC3), also designated PEAS, contains 5 Kelch repeats and may be involved in meiotic recombination process. The gene encoding KLHDC3 maps to chromosome 6, which contains around 1, 200 genes within 170 million base pairs of sequence. Deletion of a portion of the q arm of chromosome 6 is associated with early onset intestinal cancer suggesting the presence of a cancer susceptibility locus. Porphyria cutanea tarda, Parkinson's disease, Stickler syndrome, 21-hydroxylase deficiency and maple syrup urine disease are also associated with genes on chromosome 6. KLHDC3 protein is mainly expressed in cytoplasm, also found in meiotic chromatin.

Specifications

• Accession Number: Q9BQ90
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116138
• Name: Human KLDC3 (aa 87-181) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300011D16Rik; dJ20C7.3; kelch domain containing 3; kelch domain-containing protein 3; KLHDC3; Peas; Protein Peas; RP1-20C7.3; testis intracellular mediator protein
• Common Name: KLDC3
• Gene Symbol: KLHDC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining