missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212982

Invitrogen™ Human KIRREL2 (aa 228-285) Control Fragment Recombinant Protein

Product Code. 30212982
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212982

Brand: Invitrogen™ RP108630

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84950 (PA5-84950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a type I transmembrane protein and member of the immunoglobulin superfamily of cell adhesion molecules. The encoded protein localizes to adherens junctions in pancreatic beta cells and regulates insulin secretion. Autoantibodies against the encoded protein have been detected in serum from patients with type 1 diabetes. This gene may also play a role in glomerular development and decreased expression of this gene has been observed in human glomerular diseases. This gene and the related opposite-strand gene nephrin are regulated by a bidirectional promoter.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UWL6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84063
Name Human KIRREL2 (aa 228-285) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C330019F22Rik; DKFZp564A1164; FILTRIN; kin of IRRE like 2; kin of IRRE like 2 (Drosophila); kin of irregular chiasm-like 2; kin of irregular chiasm-like protein 2; kin of IRRE-like 2; kin of IRRE-like protein 2; kin of IRRE-like protein 2; LOW QUALITY PROTEIN: kin of IRRE-like protein 2; kirre like nephrin family adhesion molecule 2; KIRREL2; MGC15718; NEPH3; nephrin-like 3; nephrin-like gene 1; nephrin-like protein 3; NLG1; UNQ5827/PRO19646; x kin of IRRE like 2
Common Name KIRREL2
Gene Symbol KIRREL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.