Invitrogen™ Human Kir6.1 (KCNJ8) (aa 273-421) Control Fragment Recombinant Protein

Product Code. 30195655

Brand: Invitrogen™ RP101008

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56628 (PA5-56628. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ8 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ8, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins.Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins.

Specifications

• Accession Number: Q15842
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3764
• Name: Human Kir6.1 (KCNJ8) (aa 273-421) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI448900; ATP-sensitive inward rectifier potassium channel 8; ATP-sensitive inward rectifier potassium channel Kir6.1; gnite; Inward rectifier K(+) channel Kir6.1; inward rectifier potassium channel 6.1; inward rectifier potassium channel Kir6.1; inwardly rectifier K(+) channel Kir6.1; Inwardly rectifying potassium channel gene subfamily J-8 (ATP sensitive); Inwardly rectifying potassium channel gene, subfamily J-8 (ATP sensitive); inwardly rectifying potassium channel Kir6.1; ion channel; Kcnj8; KCNJ8 protein; Kir6.1; Kir6.1 like; potassium channel, inwardly rectifying subfamily J member 8; potassium channel, inwardly rectifying subfamily J, member 8; potassium inwardly rectifying channel subfamily J member 8; potassium inwardly-rectifying channel J8; potassium inwardly-rectifying channel, subfamily J, member 8; potassium voltage-gated channel subfamily J member 8; si:dkey-183c2.2; slmbr; sltr; UKATP1; uKATP-1; zkir6.1
• Common Name: Kir6.1 (KCNJ8)
• Gene Symbol: KCNJ8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining