Invitrogen™ Human Kir3.1 (KCNJ3) (aa 351-487) Control Fragment Recombinant Protein

Product Code. 30212301

Brand: Invitrogen™ RP90677

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.

Specifications

• Accession Number: P48549
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3760
• Name: Human Kir3.1 (KCNJ3) (aa 351-487) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EGK_04447; G protein-activated inward rectifier potassium channel 1; GIRK1; GIRK-1; HGIRK1; inward rectifier K(+) channel Kir3.1; inward rectifier K+ channel KIR3.1; Kcnf3; Kcnj3; KGA; KGB1; KIR3.1; potassium channel inwarding rectifying channel subfamily J member 3; potassium channel subunit Kir3.1 type 3 delta; potassium channel, inwardly rectifying subfamily J member 3; potassium channel, inwardly rectifying subfamily J, member 3; potassium inwardly rectifying channel subfamily J member 3; potassium inwardly-rectifying channel subfamily J member 3 splice variant 1 e; potassium inwardly-rectifying channel, subfamily J, member 3; potassium voltage-gated channel subfamily J member 3
• Common Name: Kir3.1 (KCNJ3)
• Gene Symbol: KCNJ3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining