Invitrogen™ Human Kindlin 3 (aa 461-521) Control Fragment Recombinant Protein

Product Code. 30199518

Brand: Invitrogen™ RP107411

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66753 (PA5-66753. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The three KINDLINs are a novel family of focal adhesion proteins, localizing to integrin adhesion sites. The KINDLIN proteins are composed of a centrally located FERM domain interrupted by a pleckstrin homology (PH) domain. KINDLIN1 and KINDLIN2 have been shown to play an essential role in integrin-mediated adhesion and spreading. In contrast to the widely expressed KINDLIN1 and KINDLIN2, KINDLIN3 is restricted to hematopoietic cells and is particularly abundant in megakaryocytes and platelets. Several reports describe a transcriptional misregulation of KINDLINs in various types of cancer. A recent study demonstrates that KINDLIN3 is essential for platelet integrin activation and subsequent integrin outside-in signaling, suggesting it may serve as a potential target for the design of therapeutics aimed at specifically disrupting integrin activation in platelets and leukocytes.

Specifications

• Accession Number: Q86UX7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83706
• Name: Human Kindlin 3 (aa 461-521) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C79673; fermitin family homolog 3; fermitin family homolog 3 (Drosophila); fermitin family member 3; Fermt3; Kind3; kindlin 3; Kindlin3; Kindlin-3; MGC10966; MIG-2; MIG2B; MIG2-like protein; RGD1310168; UNC-112 related protein 2; UNC112C; unc-112-related protein 2; URP2; URP2SF
• Common Name: Kindlin 3
• Gene Symbol: Fermt3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining