missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Kindlin 3 (aa 461-521) Control Fragment Recombinant Protein

Product Code. 30199518
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199518

Brand: Invitrogen™ RP107411

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66753 (PA5-66753. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The three KINDLINs are a novel family of focal adhesion proteins, localizing to integrin adhesion sites. The KINDLIN proteins are composed of a centrally located FERM domain interrupted by a pleckstrin homology (PH) domain. KINDLIN1 and KINDLIN2 have been shown to play an essential role in integrin-mediated adhesion and spreading. In contrast to the widely expressed KINDLIN1 and KINDLIN2, KINDLIN3 is restricted to hematopoietic cells and is particularly abundant in megakaryocytes and platelets. Several reports describe a transcriptional misregulation of KINDLINs in various types of cancer. A recent study demonstrates that KINDLIN3 is essential for platelet integrin activation and subsequent integrin outside-in signaling, suggesting it may serve as a potential target for the design of therapeutics aimed at specifically disrupting integrin activation in platelets and leukocytes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86UX7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83706
Name Human Kindlin 3 (aa 461-521) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C79673; fermitin family homolog 3; fermitin family homolog 3 (Drosophila); fermitin family member 3; Fermt3; Kind3; kindlin 3; Kindlin3; Kindlin-3; MGC10966; MIG-2; MIG2B; MIG2-like protein; RGD1310168; UNC-112 related protein 2; UNC112C; unc-112-related protein 2; URP2; URP2SF
Common Name Kindlin 3
Gene Symbol Fermt3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.