Invitrogen™ Human Kindlin 2 (aa 193-245) Control Fragment Recombinant Protein

Product Code. 30199178

Brand: Invitrogen™ RP109311

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Scaffolding protein that enhances integrin activation mediated by TLN1 and/or TLN2, but activates integrins only weakly by itself. Binds to membranes enriched in phosphoinositides. Enhances integrin-mediated cell adhesion onto the extracellular matrix and cell spreading; this requires both its ability to interact with integrins and with phospholipid membranes. Required for the assembly of focal adhesions. Participates in the connection between extracellular matrix adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits FBLIM1 to focal adhesions. Plays a role in the TGFB1 and integrin signaling pathways. Stabilizes active CTNNB1 and plays a role in the regulation of transcription mediated by CTNNB1 and TCF7L2/TCF4 and in Wnt signaling. [UniProt]

Specifications

• Accession Number: Q96AC1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10979
• Name: Human Kindlin 2 (aa 193-245) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA960555; EGK_18193; Fermitin family homolog 2; fermitin family homolog 2 (Drosophila); fermitin family member 2; fermt2; im:7145859; im:7145859 protein; KIND2; kindlin 2; kindlin-2; LOC616981 protein; MIG2; mig-2; mitogen inducible 2; mitogen inducible gene 2 protein; mitogen-inducible gene 2 protein; PH domain-containing family C member 1; pleckstrin homology domain containing, family C (with FERM domain) member 1; pleckstrin homology domain containing, family C member 1; pleckstrin homology domain-containing family C member 1; Plekhc1; UNC112; UNC112B
• Common Name: Kindlin 2
• Gene Symbol: FERMT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining