Invitrogen™ Human KIN (aa 173-245) Control Fragment Recombinant Protein

Product Code. 30198152

Brand: Invitrogen™ RP104693

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65220 (PA5-65220. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kin is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by the human ortholog.

Specifications

• Accession Number: O60870
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22944
• Name: Human KIN (aa 173-245) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: antigenic determinant of rec-A protein; antigenic determinant of rec-A protein homolog; binding to curved DNA; Btcd; DNA/RNA-binding protein KIN17; HsKin17 protein; KIN; KIN, antigenic determinant of recA protein; KIN, antigenic determinant of recA protein homolog; KIN17; Kin17 DNA and RNA binding protein; Rts2
• Common Name: KIN
• Gene Symbol: Kin
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSSGATSSKSSTLGPSALKTIGSSASVKRKESS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining