Invitrogen™ Human KIF19 (aa 4-82) Control Fragment Recombinant Protein

Product Code. 30198431

Brand: Invitrogen™ RP107922

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67284 (PA5-67284. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plus end-directed microtubule-dependent motor protein that regulates the length of motile cilia by mediating depolymerization of microtubules at ciliary tips.

Specifications

• Accession Number: Q2TAC6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 124602
• Name: Human KIF19 (aa 4-82) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KIF19; Kif19a; KIF19A-like protein; kinesin family member 19; kinesin family member 19 A; kinesin-like protein KIF19; N-8 kinesin; oocyte-G1; RGD1559936
• Common Name: KIF19
• Gene Symbol: KIF19
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining