Invitrogen™ Human KIF13B (aa 1369-1453) Control Fragment Recombinant Protein

Product Code. 30206582

Brand: Invitrogen™ RP93952

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55207 (PA5-55207. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KIF13B (Kinesin Family Member 13B) is a Protein Coding gene. Diseases associated with KIF13B includeSpastic Paraplegia 37, Autosomal DominantandSpastic Paraplegia 11, Autosomal Recessive. Among its related pathways areGolgi-to-ER retrograde transportandFactors involved in megakaryocyte development and platelet production. Gene Ontology (GO) annotations related to this gene includeprotein kinase bindingandmicrotubule motor activity.

Specifications

• Accession Number: Q9NQT8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23303
• Name: Human KIF13B (aa 1369-1453) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5330429L19Rik; 6030414C01; AI429803; C130021D12Rik; GAKIN; guanylate kinase associated kinesin; KIAA0639; Kif13b; kinesin 13 B; kinesin family member 13 B; kinesin-like protein GAKIN; Kinesin-like protein KIF13B; N-3 kinesin
• Common Name: KIF13B
• Gene Symbol: KIF13B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASYLNP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining