Invitrogen™ Human KIAA1751 (aa 557-644) Control Fragment Recombinant Protein

Product Code. 30194584

Brand: Invitrogen™ RP94252

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55889 (PA5-55889. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

As part of the central apparatus of the cilium axoneme may play a role in cilium movement. [UniProt]

Specifications

• Accession Number: Q9C0B2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85452
• Name: Human KIAA1751 (aa 557-644) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C1orf222; CFAP74; cilia and flagella associated protein 74; cilia- and flagella-associated protein 74; FLJ45476; hCG1647286-like; KIAA1751; LOW QUALITY PROTEIN: cilia- and flagella-associated protein 74
• Common Name: KIAA1751
• Gene Symbol: CFAP74
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLRDFIHVDFDPPGPLSAGMSCEVLVTFKPMINKDLEGNISFLAQTGEFSVPLKCSTKKCSLSLDKELIDFGSYVVGETTSRTITLTN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining