Invitrogen™ Human KIAA1429 (aa 1049-1146) Control Fragment Recombinant Protein

Product Code. 30201695

Brand: Invitrogen™ RP93880

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56772 (PA5-56772. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KIAA1429 is required for N6-methyladenosine (m6A) methylation of mRNAs, a modification that plays a role in the efficiency of mRNA splicing and processing. It is also Involved in mRNA splicing regulation, probably via its function in m6A methylation. Diseases associated with KIAA1429 include Retinitis Pigmentosa 42.

Specifications

• Accession Number: Q69YN4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25962
• Name: Human KIAA1429 (aa 1049-1146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110037F02Rik; 4930422M05Rik; DKFZP434I116; fSAP121; functional spliceosome-associated protein 121; KIAA1429; mKIAA1429; MSTP054; protein virilizer homolog; RGD1559904; RIKEN cDNA 1110037F02 gene; similar to mKIAA1429 protein; Virma
• Common Name: KIAA1429
• Gene Symbol: VIRMA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVALNTRKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining