Invitrogen™ Human KIAA1328 (aa 287-378) Control Fragment Recombinant Protein

Product Code. 30180700

Brand: Invitrogen™ RP98254

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59365 (PA5-59365. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Competes with SMC1 for binding to SMC3. May affect the availability of SMC3 to engage in the formation of multimeric protein complexes.

Specifications

• Accession Number: Q86T90
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57536
• Name: Human KIAA1328 (aa 287-378) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921538P22; AI461742; AW554918; expressed sequence AW554918; hinderin; KIAA1328; mKIAA1328; Protein hinderin; uncharacterized protein KIAA1328; uncharacterized protein KIAA1328; protein hinderin
• Common Name: KIAA1328
• Gene Symbol: KIAA1328
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QEELHMKECPHLKPTPSQCCGHRLAADRVHDSHPTNMTPQHPKTHPESCSYCRLSWASLVHGGGALQPIETLKKQISEDRKQQLMLQKMELE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining