Invitrogen™ Human KIAA1310 (aa 574-668) Control Fragment Recombinant Protein

Product Code. 30211208

Brand: Invitrogen™ RP106001

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65291 (PA5-65291. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

As part of the NSL complex it is involved in acetylation of nucleosomal histone H4 on several lysine residues and therefore may be involved in the regulation of transcription.

Specifications

• Accession Number: Q9P2N6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55683
• Name: Human KIAA1310 (aa 574-668) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KANSL3; KAT8 regulatory NSL complex subunit 3; KIAA1310; Non-specific lethal 3 homolog; NSL complex protein NSL3; NSL3; PRTD; Rcd1; serum inhibited-related protein; SI1; Testis development protein PRTD
• Common Name: KIAA1310
• Gene Symbol: KANSL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTHKQAQVPISSEPPEEGEKEDLRVQLKRHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPITMTLGQASAGAKELTGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining