Invitrogen™ Human KIAA0701 (aa 1157-1249) Control Fragment Recombinant Protein

Product Code. 30181312

Brand: Invitrogen™ RP97708

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58875 (PA5-58875. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UHRF1BP1L gene ontology annotations related to this gene include GARP complex binding; protein homodimerization activity.

Specifications

• Accession Number: A0JNW5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23074
• Name: Human KIAA0701 (aa 1157-1249) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010319N22Rik; 4930506D01Rik; AA589495; C80672; E030041M21Rik; Kiaa0701; mKIAA0701; SHIP164; syntaxin 6 Habc-interacting protein of 164 kDa; Syntaxin-6 Habc-interacting protein of 164 kDa; UHRF1 (ICBP90) binding protein 1-like; UHRF1 binding protein 1 like; UHRF1 binding protein 1-like; UHRF1-binding protein 1-like; UHRF1BP1L
• Common Name: KIAA0701
• Gene Symbol: Uhrf1bp1l
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVNAGANLQNYGETSPDAISTNSEGAQENHDDLMSVVVFKITGVNGEIDIRGEDTEICLQVNQVTPDQLGNISLRHYLCNRPVGSDQKAVIHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining