Invitrogen™ Human KIAA0196 (aa 723-815) Control Fragment Recombinant Protein

Product Code. 30195436

Brand: Invitrogen™ RP107779

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67132 (PA5-67132. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a 134 kDa protein named strumpellin that is predicted to have multiple transmembrane domains and a spectrin-repeat-containing domain. This ubiquitously expressed gene has its highest expression in skeletal muscle. The protein is named for Strumpell disease; a form of hereditary spastic paraplegia (HSP). Spastic paraplegias are a diverse group of disorders in which the autosomal dominant forms are characterized by progressive, lower extremity spasticity caused by axonal degeneration in the terminal portions of the longest descending and ascending corticospinal tracts. More than 30 loci (SPG1-33) have been implicated in hereditary spastic paraplegia diseases.

Specifications

• Accession Number: Q12768
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9897
• Name: Human KIAA0196 (aa 723-815) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL022848; C76463; E430025E21Rik; KIAA0196; mKIAA0196; RGD1564420; RIKEN cDNA E430025E21 gene; RTSC; RTSC1; similar to Hypothetical protein MGC31278; SPG8; Strumpellin; uncharacterized protein LOC362919; WASH complex subunit 5; WASH complex subunit strumpellin; WASHC5
• Common Name: KIAA0196
• Gene Symbol: WASHC5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining