Invitrogen™ Human KIAA0100 (aa 2096-2202) Control Fragment Recombinant Protein

Product Code. 30213087

Brand: Invitrogen™ RP100185

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60118 (PA5-60118. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Belongs to the UPF0378 family. 4 isoforms of the human protein are produced by alternative splicing. Song J., Biochim. Biophys. Acta 1760:62-69(2006). Nagase T., DNA Res. 2:37-43(1995). Chen G., Leuk. Res. 29:503-509(2005).

Specifications

• Accession Number: Q14667
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9703
• Name: Human KIAA0100 (aa 2096-2202) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Antigen MLAA-22; BCOX; BCO x 1; breast cancer overexpressed gene 1; breast cancer-overexpressed gene 1 protein; cancer/testis antigen 101; CT101; FMP27; K0100; KIAA0100; protein KIAA0100; U937-associated antigen
• Common Name: KIAA0100
• Gene Symbol: KIAA0100
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EHPVDDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEKNSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKRDSRKALVAQVIKEKLRLKSATGSEVRGKLETKSDLN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining