Invitrogen™ Human KHSRP (aa 517-567) Control Fragment Recombinant Protein

Product Code. 30201221

Brand: Invitrogen™ RP106708

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization.

Specifications

• Accession Number: Q92945
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8570
• Name: Human KHSRP (aa 517-567) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330409F21Rik; Far upstream element-binding protein 2; FBP2; Fubp2; FUSE binding protein 2; FUSE-binding protein 2; KH type-splicing regulatory protein; KHE3; KHSRP; KH-type splicing regulatory protein; KH-type splicing regulatory protein (FUSE binding protein 2); KSRP; MAP2 RNA trans-acting protein 1; MAP2 RNA trans-acting protein MARTA1; MARTA1; p75
• Common Name: KHSRP
• Gene Symbol: KHSRP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining