Invitrogen™ Human KHK (aa 185-284) Control Fragment Recombinant Protein

Product Code. 30207617

Brand: Invitrogen™ RP89759

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82277 (PA5-82277. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver. renal cortex. and small intestine. while the alternate variant encodes the lowe

Specifications

• Accession Number: P50053
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3795
• Name: Human KHK (aa 185-284) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: fructokinase; hepatic fructokinase; KETHPRO; ketohexokinase; ketohexokinase (fructokinase); ketohexokinase isoform a; Khk; testicular tissue protein Li 102
• Common Name: KHK
• Gene Symbol: KHK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining