Invitrogen™ Human KHDRBS3 (aa 181-286) Control Fragment Recombinant Protein

Product Code. 30194390

Brand: Invitrogen™ RP93686

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-51372 (PA5-51372, PA5-64874 (PA5-64874. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

Specifications

• Accession Number: O75525
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10656
• Name: Human KHDRBS3 (aa 181-286) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Etle; etoile; etoile, Sam68-like protein SLM-2; KH domain containing, RNA binding, signal transduction associated 3; KH domain-containing, RNA-binding, signal transduction-associated protein 3; KH RNA binding domain containing, signal transduction associated 3; KHDRBS3; RNA-binding protein Etoile; RNA-binding protein T-Star; rSLM-2; SALP; Sam68-like mammalian protein 2; Sam68-like phosphotyrosine protein; Sam68-like phosphotyrosine protein, T-STAR; SLM2; SLM-2; TSTAR; T-STAR
• Common Name: KHDRBS3
• Gene Symbol: Khdrbs3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining