Invitrogen™ Human KDELC2 (aa 45-127) Control Fragment Recombinant Protein

Product Code. 30197966

Brand: Invitrogen™ RP97504

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58730 (PA5-58730. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KDELC2 is a protein coding gene.

Specifications

• Accession Number: Q7Z4H8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 143888
• Name: Human KDELC2 (aa 45-127) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KDEL (Lys-Asp-Glu-Leu) containing 2; KDEL motif containing 2; KDEL motif-containing protein 2; KDELC2; POGLUT3; Protein O-glucosyltransferase 3; Protein O-xylosyltransferase POGLUT3; UNQ1904/PRO4350
• Common Name: KDELC2
• Gene Symbol: KDELC2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPVRYFYLQAVNSEGQNLTRSPAGETPFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETVDEGLKIEVLYGDEHVAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining