Invitrogen™ Human KDELC1 (aa 27-97) Control Fragment Recombinant Protein

Codice prodotto. 30195379

Marca: Invitrogen™ RP106057

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65374 (PA5-65374. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein glucosyltransferase that catalyzes the transfer of glucose from UDP-glucose to a serine residue within the consensus sequence peptide C-X-N-T-X-G-S-F-X-C. Can also catalyze the transfer of xylose from UDP-xylose but less efficiently. Specifically targets extracellular EGF repeats of proteins such as NOTCH1 and NOTCH3. May regulate the transport of NOTCH1 and NOTCH3 to the plasma membrane and thereby the Notch signaling pathway.

Specifica

• Accession Number: Q6UW63
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79070
• Name: Human KDELC1 (aa 27-97) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: endoplasmic reticulum resident protein 58; EP58; ER protein 58; ERp58; KDEL (Lys-Asp-Glu-Leu) containing 1; KDEL motif containing 1; KDEL motif-containing 1; KDEL motif-containing protein 1; KDEL1; KDELC1; POGLUT2; Protein O-glucosyltransferase 2; Protein O-xylosyltransferase POGLUT2; UNQ1910/PRO4357
• Common Name: KDELC1
• Gene Symbol: KDELC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGNKFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining