missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KDELC1 (aa 134-209) Control Fragment Recombinant Protein

Product Code. 30209703
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209703

Brand: Invitrogen™ RP107334

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66684 (PA5-66684. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein glucosyltransferase that catalyzes the transfer of glucose from UDP-glucose to a serine residue within the consensus sequence peptide C-X-N-T-X-G-S-F-X-C. Can also catalyze the transfer of xylose from UDP-xylose but less efficiently. Specifically targets extracellular EGF repeats of proteins such as NOTCH1 and NOTCH3. May regulate the transport of NOTCH1 and NOTCH3 to the plasma membrane and thereby the Notch signaling pathway.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UW63
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79070
Name Human KDELC1 (aa 134-209) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias endoplasmic reticulum resident protein 58; EP58; ER protein 58; ERp58; KDEL (Lys-Asp-Glu-Leu) containing 1; KDEL motif containing 1; KDEL motif-containing 1; KDEL motif-containing protein 1; KDEL1; KDELC1; POGLUT2; Protein O-glucosyltransferase 2; Protein O-xylosyltransferase POGLUT2; UNQ1910/PRO4357
Common Name KDELC1
Gene Symbol KDELC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HENCDCPLQDSAAWLREMNCPETIAQIQRDLAHFPAVDPEKIAVEIPKRFGQRQSLCHYTLKDNKVYIKTHGEHVG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.