Invitrogen™ Human KCTD6 (aa 168-237) Control Fragment Recombinant Protein

Product Code. 30203217

Brand: Invitrogen™ RP102696

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57520 (PA5-57520. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KCTD6 is a domain of potassium channel.

Specifications

• Accession Number: Q8NC69
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 200845
• Name: Human KCTD6 (aa 168-237) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430433B02Rik; AU044285; BTB/POZ domain-containing protein KCTD6; hypothetical protein LOC436601; KCASH3; KCASH3 protein; KCTD6; kctd6b; potassium channel tetramerisation domain containing 6; potassium channel tetramerisation domain containing 6 b; potassium channel tetramerization domain containing 6; potassium channel tetramerization domain containing 6 b; Potassium channel tetramerization domain-containing protein 6; zgc:91884
• Common Name: KCTD6
• Gene Symbol: KCTD6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining