Invitrogen™ Human KCTD11 (aa 71-145) Control Fragment Recombinant Protein

Product Code. 30197211

Brand: Invitrogen™ RP100331

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62539 (PA5-62539. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calponin, a thin filament associated protein is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. Calponin is expressed in smooth muscle and tissues containing significant amounts of smooth muscle. Two isoforms of calponin exist whose molecular weights are 34kDa and 29kDa. Expression of the 29kDa form is primarily restricted to muscle of the urogenital tract. The expression of calponin has also been demonstrated in myoepithelial cells from benign and malignant breast lesions. It stains smooth muscle, myoepithelial cells, myofibroblasts, keratinocytes and nerve fibers. It identifies myoepithelial cells in breast lesions, and helps differentiate breast collagenous spherulosis (positive) from adenoid cystic carcinoma. Adenoid cystic carcinoma in salivary gland tumors is calponin positive.

Specifications

• Accession Number: Q693B1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 147040
• Name: Human KCTD11 (aa 71-145) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AF465352; BTB/POZ domain-containing protein KCTD11; C17orf36; KCASH1; KCASH1 protein; KCTD11; potassium channel tetramerisation domain containing 11; potassium channel tetramerization domain containing 11; potassium channel tetramerization domain-containing protein 11; REN; REN/KCTD11; retinoic acid, EGF, and NGF upregulated; retinoic acid, EGF, NGF induced gene protein; retinoic acid, EGF, NGF induced gene/potassium channel tetramerization domain containing 11; RING-type E3 ubiquitin transferase KCTD11; RING-type E3 ubiquitin transferase subunit KCTD11
• Common Name: KCTD11
• Gene Symbol: KCTD11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining