Invitrogen™ Human KCNV2 (aa 16-116) Control Fragment Recombinant Protein

Product Code. 30211273

Brand: Invitrogen™ RP91094

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56652 (PA5-56652. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KCNV2 is a potassium channel subunit. Modulates channel activity by shifting the threshold and the half-maximal activation to more negative values.

Specifications

• Accession Number: Q8TDN2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 169522
• Name: Human KCNV2 (aa 16-116) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Kcnv2; KV11.1; Kv8.2; potassium channel, subfamily V, member 2; potassium channel, voltage gated modifier subfamily V, member 2; potassium channel, voltage-gated modifier subfamily V, member 2; potassium voltage-gated channel modifier subfamily V member 2; potassium voltage-gated channel subfamily V member 2; RCD3B; voltage-gated potassium channel subunit Kv8.2
• Common Name: KCNV2
• Gene Symbol: KCNV2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining