Invitrogen™ Human KCNT2 (aa 957-1012) Control Fragment Recombinant Protein

Product Code. 30200153

Brand: Invitrogen™ RP101419

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62348 (PA5-62348. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kcnt2 calcium (Ca2+) -activated potassium channels (KCa) are a group of 6/7-TM ion channels that selectively transport K+ ions across biological membranes. KCa channels are broadly classified into three subtypes: SK, IK and BK channels (small, intermediate and big conductance). Kcnt2 is an outward rectifying potassium channel, and produces rapidly activating outward rectifier K(+) currents. Kcnt2 is activated by high intracellular sodium and chloride levels. Further, Kcnt2 channel activity is inhibited by ATP and by inhalation anesthetics, such as isoflurane. Functionally, Kcnt2 is inhibited upon stimulation of G-protein coupled receptors, such as CHRM1 and GRIA1.

Specifications

• Accession Number: Q6UVM3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 343450
• Name: Human KCNT2 (aa 957-1012) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: E330038N15Rik; KCa4.2; Kcnt2; Potassium channel subfamily T member 2; potassium channel, sodium activated subfamily T, member 2; potassium channel, sodium-activated subfamily T, member 2; potassium channel, subfamily T, member 2; potassium sodium-activated channel subfamily T member 2; sequence like an intermediate conductance potassium channel subunit; SLICK; SLO2.1; sodium- and chloride-activated ATP-sensitive potassium channel; sodium and chloride-activated ATP-sensitive potassium channel Slo2.1; sodium- and chloride-activated ATP-sensitive potassium channel subunit; sodium-and chloride-activated ATP-sensitive potassium channel (SLICK)
• Common Name: KCNT2
• Gene Symbol: Kcnt2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining