missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KCNT2 (aa 957-1012) Control Fragment Recombinant Protein

Product Code. 30200153
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200153

Brand: Invitrogen™ RP101419

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62348 (PA5-62348. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kcnt2 calcium (Ca2+) -activated potassium channels (KCa) are a group of 6/7-TM ion channels that selectively transport K+ ions across biological membranes. KCa channels are broadly classified into three subtypes: SK, IK and BK channels (small, intermediate and big conductance). Kcnt2 is an outward rectifying potassium channel, and produces rapidly activating outward rectifier K(+) currents. Kcnt2 is activated by high intracellular sodium and chloride levels. Further, Kcnt2 channel activity is inhibited by ATP and by inhalation anesthetics, such as isoflurane. Functionally, Kcnt2 is inhibited upon stimulation of G-protein coupled receptors, such as CHRM1 and GRIA1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UVM3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 343450
Name Human KCNT2 (aa 957-1012) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias E330038N15Rik; KCa4.2; Kcnt2; Potassium channel subfamily T member 2; potassium channel, sodium activated subfamily T, member 2; potassium channel, sodium-activated subfamily T, member 2; potassium channel, subfamily T, member 2; potassium sodium-activated channel subfamily T member 2; sequence like an intermediate conductance potassium channel subunit; SLICK; SLO2.1; sodium- and chloride-activated ATP-sensitive potassium channel; sodium and chloride-activated ATP-sensitive potassium channel Slo2.1; sodium- and chloride-activated ATP-sensitive potassium channel subunit; sodium-and chloride-activated ATP-sensitive potassium channel (SLICK)
Common Name KCNT2
Gene Symbol Kcnt2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.