Invitrogen™ Human KCNS3 Control Fragment Recombinant Protein

Product Code. 30212353

Brand: Invitrogen™ RP91106

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53247 (PA5-53247. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: Q9BQ31
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3790
• Name: Human KCNS3 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Delayed-rectifier K(+) channel alpha subunit 3; Kcns3; KV9.3; potassium voltage-gated channel delayed-rectifier protein S3; potassium voltage-gated channel modifier subfamily S member 3; potassium voltage-gated channel subfamily S member 3; potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3; potassium voltage-gated channel, modifier subfamily S, member 3; Shab-related delayed-rectifier K+ channel (Kv9.3); Shab-related delayed-rectifier K+ channel alpha subunit 3; voltage-gated potassium channel protein Kv9.3; voltage-gated potassium channel subunit Kv9.3
• Common Name: KCNS3
• Gene Symbol: KCNS3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining