Invitrogen™ Human KCNQ5 (aa 639-754) Control Fragment Recombinant Protein

Product Code. 30201532

Brand: Invitrogen™ RP91239

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110817 (PA5-110817. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KCNQs are members of the voltage-dependent non-inactivating potassium channel family. Currently there are five known KNCQs (KCNQ1-5) found in the central nervous system. Studies have shown that KCNQ3 and KCNQ5 form heteromultimers that, when formed, substantially increase the M-current. Inhibition of M-current controls neuron excitability throughout the nervous system as well as the responsiveness to synaptic inputs. Genetic mutations in these proteins have been linked to disorders such as benign familial neonatal convulsions (BFNC), deafness, neuropathic pain and epilepsy. Voltage-dependent potassium channels are key regulators of the resting membrane potential and modulate the excitability of electrically active cells. The channels are usually tetrameric and can interact with auxiliary subunits that enhance or modify currents mediated by the pore-forming subunits.

Specifications

• Accession Number: Q9NR82
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56479
• Name: Human KCNQ5 (aa 639-754) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 7730402H11; 9230107O05Rik; AA589396; D1Mgi1; KCNQ5; Kcnq5l; KQT-like 5; Kv7.5; KvLQT5; potassium channel protein; potassium channel subunit alpha KvLQT5; potassium channel, voltage gated KQT-like subfamily Q, member 5; potassium channel, voltage-gated KQT-like subfamily Q, member 5; potassium voltage-gated channel subfamily KQT member 5; potassium voltage-gated channel subfamily Q member 5; potassium voltage-gated channel, KQT-like subfamily, member 5; potassium voltage-gated channel, subfamily Q, member 5; rCG_43583; voltage-gated potassium channel subunit Kv7.5; voltage-gated potassium channel type Kv7.5
• Common Name: KCNQ5
• Gene Symbol: KCNQ5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining