missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KCNN4 (aa 319-425) Control Fragment Recombinant Protein

Product Code. 30199965
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199965

Brand: Invitrogen™ RP110219

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144709 (PA5-144709. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. The encoded protein may be part of the predominant calcium-activated potassium channel in T-lymphocytes. This gene is similar to other KCNN family potassium channel genes, but it differs enough to possibly be considered as part of a new subfamily.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15554
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3783
Name Human KCNN4 (aa 319-425) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DHS2; HIK1; hIKCa1; hKCa4; hSK4; IK; IK1; IKCa; IKCA1; intermediate conductance calcium-activated potassium channel protein 1; intermediate conductance calcium-activated potassium channel protein 4; intermediate conductance K channel; intermediate-conductance Ca-activated K channel; intermediate-conductance calcium-activated potassium channel; KCa3.1; KCA4; KCNN 4; KCNN4; mIKCa1; potassium calcium-activated channel subfamily N member 4; potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 4; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4; putative erythrocyte intermediate conductance calcium-activated potassium Gardos channel; putative Gardos channel; rKCNN4c; rSK4; SK4; SKCa 4; SKCa4; SKCas; small conductance calcium-activated potassium channel 4
Common Name KCNN4
Gene Symbol Kcnn4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.