Invitrogen™ Human KCNN3 (aa 197-262) Control Fragment Recombinant Protein

Product Code. 30203911

Brand: Invitrogen™ RP106751

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66058 (PA5-66058. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. KCNN3, a member of the KCNN family of potassium channel genes, encodes a protein that is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits.

Specifications

• Accession Number: Q9UGI6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3782
• Name: Human KCNN3 (aa 197-262) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: hSK3; K3; KCa2.3; Kcnn3; potassium calcium-activated channel subfamily N member 3; potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 3; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3; SK3; SKCa 3; SKCa3; small conductance calcium-activated potassium channel 3; small conductance calcium-activated potassium channel protein 3; small-conductance Ca2+-activated K+ channel 3
• Common Name: KCNN3
• Gene Symbol: KCNN3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining