Invitrogen™ Human KCNMB4 (aa 38-87) Control Fragment Recombinant Protein

Product Code. 30212396

Brand: Invitrogen™ RP107871

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67237 (PA5-67237. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit.

Specifications

• Accession Number: Q86W47
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27345
• Name: Human KCNMB4 (aa 38-87) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700058G18Rik; 2900045G12Rik; big potassium channel beta subunit 4; BK channel beta subunit 4; BK channel subunit beta-4; BKbeta4; calcium activated potassium channel beta 4 subunit; calcium-activated potassium channel subunit beta-4; Calcium-activated potassium channel, subfamily M subunit beta-4; charybdotoxin receptor subunit beta-4; hbeta4; k(VCA)beta-4; KCMB4; KCNMB4; large conductance calcium-dependent potassium ion channel beta 4 subunit; maxi K channel subunit beta-4; MaxiK channel beta-subunit 4; potassium calcium-activated channel subfamily M regulatory beta subunit 4; potassium channel subfamily M regulatory beta subunit 4; potassium large conductance calcium-activated channel, subfamily M, beta member 4; slo-beta-4; Slowpoke beta 4
• Common Name: KCNMB4
• Gene Symbol: KCNMB4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining