Invitrogen™ Human KCNMA1 (aa 917-1031) Control Fragment Recombinant Protein

Product Code. 30181155

Brand: Invitrogen™ RP98507

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Potassium channels are a group of ubiquitously expressed proteins that serve numerous functions in excitable and non-excitable cells. One class of integral membrane potassium channels is the large conductance, calcium-activated potassium channel (Maxi K+). Maxi K+ differs from most other potassium channels in that its activation is controlled by both increases in intracellular calcium and by membrane depolarization. Maxi K+ dual activation is possible because of its structure. The core of the channel, which is similar to other potassium channels, is a Maxi K+ alpha homotetramer that contains both a voltage sensor and an intracellular calcium binding domain. In vascular smooth muscle, an auxiliary beta-subunit is found in a 1:1 stoichiometry. The beta-subunit exhibits its effect on the Maxi K+ channel by effectively decreasing by 5- to 10- fold the concentration of calcium required to keep the pore open.

Specifications

• Accession Number: Q12791
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3778
• Name: Human KCNMA1 (aa 917-1031) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730414M22Rik; bA205K10.1; big potassium channel alpha subunit; BK channel; BK channel alpha subunit; BKCa; BKCA alpha; BKCA alpha subunit; BKTM; calcium-activated potassium channel alpha subunit; calcium-activated potassium channel subunit alpha-1; calcium-activated potassium channel subunit alpha-1; uncharacterized protein; calcium-activated potassium channel, subfamily M subunit alpha-1; hSlo; K(VCA)alpha; KCa1.1; Kcnma; Kcnma1; KCNMA1b; KCNMA1c; Maxi K channel; maxiK; maxi-K channel HSLO; mSlo; mSlo1; potassium calcium-activated channel subfamily M alpha 1; potassium channel, calcium activated large conductance subfamily M alpha, member 1; potassium large conductance calcium-activated channel, subfamily M, alpha member 1; SAKCA; SLO; slo homolog; slo1; Slo-alpha; Slowpoke homolog; stretch-activated Kca channel
• Common Name: KCNMA1
• Gene Symbol: Kcnma1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: INLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining