Invitrogen™ Human KCNK7 (aa 33-92) Control Fragment Recombinant Protein

Product Code. 30207433

Brand: Invitrogen™ RP108118

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67461 (PA5-67461. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel; however, it may require other non-pore-forming proteins for activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: Q9Y2U2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10089
• Name: Human KCNK7 (aa 33-92) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: K2p7.1; KCNK7; Potassium channel subfamily K member 7; potassium channel, subfamily K, member 7; potassium channel, two pore domain subfamily K, member 7; potassium two pore domain channel subfamily K member 7; RGD1565025; TWIK3; two pore domain K+ channel
• Common Name: KCNK7
• Gene Symbol: KCNK7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQAHGVSTLGNSSEGRTWDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining