Invitrogen™ Human KCNK10 (aa 397-502) Control Fragment Recombinant Protein

Product Code. 30197175

Brand: Invitrogen™ RP89121

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56480 (PA5-56480. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KCNK10 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene.

Specifications

• Accession Number: P57789
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54207
• Name: Human KCNK10 (aa 397-502) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700024D23Rik; 2 P domain potassium channel TREK2; 3010005K24Rik; K2p10.1; Kcnk10; Outward rectifying potassium channel protein TREK-2; outward rectifying potassium channel TREK2; potassium channel subfamily K member 10; potassium channel TREK-2; potassium channel, subfamily K, member 10; potassium channel, two pore domain subfamily K, member 10; potassium two pore domain channel subfamily K member 10; PPP1R97; protein phosphatase 1, regulatory subunit 97; TREK2; TREK-2; TREK-2 K(+) channel subunit; TREK-2 two-pore-domain K+ channel; TWIK-related K+ channel 2
• Common Name: KCNK10
• Gene Symbol: KCNK10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining