missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210513

Invitrogen™ Human KCNIP1 (aa 3-57) Control Fragment Recombinant Protein

Produktkode 30210513
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
Förpackningsstorlek
100µL
Denne vare kan ikke returneres. Se returpolitik

Produktkode 30210513

missing translation for 'mfr': Invitrogen™ RP93631

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82801 (PA5-82801. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.
TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number Q9NZI2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 30820
Name Human KCNIP1 (aa 3-57) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ABP; A-type potassium channel modulatory protein 1; A-type potassium channel modulatory protein 1.2; KChIP1; Kchip1.2; KCHIP2; Kcnip1; Kv channel interacting protein 1; Kv channel-interacting protein 1; potassium channel interacting protein 1; potassium channel-interacting protein 1; potassium voltage-gated channel interacting protein 1; VABP; Vesicle APC-binding protein
Common Name KCNIP1
Gene Symbol Kcnip1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.