missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KCNH8 (aa 1010-1104) Control Fragment Recombinant Protein

Product Code. 30209800
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209800

Brand: Invitrogen™ RP109648

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96L42
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 131096
Name Human KCNH8 (aa 1010-1104) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C130090D05Rik; ELK; ELK channel 3; ELK1; Elk3; ether-a-go-go-like potassium channel 1; ether-a-go-go-like potassium channel 3; Ets-1; hElk1; Kcnh8; Kv12.1; potassium channel, voltage gated eag related subfamily H, member 8; potassium voltage-gated channel subfamily H member 8; potassium voltage-gated channel, subfamily H (eag-related), member 8; potassium voltage-gated channel, subfamily H, member 8; voltage-gated potassium channel subunit Kv12.1
Common Name KCNH8
Gene Symbol Kcnh8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RCISPHSDSTLTPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASASTKPLENLPLEVVTSTAEVKDNKA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.