Invitrogen™ Human KCNH1 (aa 878-981) Control Fragment Recombinant Protein

Product Code. 30194616

Brand: Invitrogen™ RP91156

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64954 (PA5-64954, PA5-53989 (PA5-53989. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH1 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH1 is activated at the onset of myoblast differentiation. KCNH1 is highly expressed in brain and in myoblasts. Overexpression of KCNH1 may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of KCNH1 results in two transcript variants encoding distinct isoforms.

Specifications

• Accession Number: O95259
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3756
• Name: Human KCNH1 (aa 878-981) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EAG; EAG channel 1; EAG1; ether a go-go; ether-a-go-go potassium channel 1; ether-a-go-go, Drosophila, homolog of; h-eag; hEAG1; Kcnh1; Kv10.1; M-eag; potassium channel, voltage gated eag related subfamily H, member 1; potassium voltage-gated channel subfamily H member 1; potassium voltage-gated channel, subfamily H (eag-related), member 1; r-eag; TMBTS; voltage-gated potassium channel subunit Kv10.1; ZLS1
• Common Name: KCNH1
• Gene Symbol: KCNH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining